SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017694 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017694
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-56
Family SPRY domain 0.0000478
Further Details:      
 
Domain Number 2 Region: 8-76
Classification Level Classification E-value
Superfamily RING/U-box 2.01e-20
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Domain Number 3 Region: 93-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000946
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000017694
Domain Number - Region: 132-195
Classification Level Classification E-value
Superfamily t-snare proteins 0.0118
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017694   Gene: ENSMLUG00000025631   Transcript: ENSMLUT00000024759
Sequence length 468
Comment pep:putative scaffold:Myoluc2.0:GL430060:580432:581838:-1 gene:ENSMLUG00000025631 transcript:ENSMLUT00000024759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEGAVANLQIEINCPICLDNLRDPVTIECGHNFCRSCIERSWADVQDRFPCPVCRHPC
KERHLWSNTQLGRMVDIAKLLQITGAKMKQQEERRLCEKHNQALTLFCEEDLKLLCPLCT
QPPDHQGHHVRPVEEAASHHRQKLRSYIEPLKKQLADLQKLLATQDRQQSELREKVEKRR
AKLASEYESVIASIEIEQAAVHSRLAAQEKHVLQNLTANKAAFSDHISKLRVLRKEMAET
SVVSDVKLLMNIKGVLPRCDNLEPPDVYCLKYKREEFSLPPQCSALLQIMQTFREEVTLD
PETAHPHLLVSEDKKSVTFVRKKQGVHRNPKGFADDAVVLGSEGFDCGRHYWEVQVDDKP
EWAVGVCTDSLSKERKQPLLRQENRCWTIQLQDGDYVARGPVPVTLVLQEMPRGIGIYLD
YEMGHVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD
Download sequence
Identical sequences G1Q1W1
XP_006100042.1.53796 ENSMLUP00000017694 ENSMLUP00000017694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]