SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017719 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017719
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-38
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-36
Family Link domain 0.00000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017719   Gene: ENSMLUG00000028087   Transcript: ENSMLUT00000029244
Sequence length 277
Comment pep:putative scaffold:Myoluc2.0:GL430005:341170:353023:-1 gene:ENSMLUG00000028087 transcript:ENSMLUT00000029244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFVLLWEDAHGWGFKNGIFHNSIWLEQAAGVYHREARSGKYKLTYTEAKAVCEY
EGGRLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPHCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGIFTDPKRIFKSPGYPNEYDDNQICYWHIRLKYGQRIHLKFLDF
DLEDDPSCLADYVEIYDSYDDIHGFVGRYCGDELPEDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPLSNSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences G1Q1Y6
XP_006098546.1.53796 ENSMLUP00000017719 ENSMLUP00000017719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]