SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018553 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018553
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 7.53e-24
Family Pyrin domain, PYD 0.0000494
Further Details:      
 
Domain Number 2 Region: 115-195
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-16
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018553   Gene: ENSMLUG00000023229   Transcript: ENSMLUT00000028804
Sequence length 197
Comment pep:putative scaffold:Myoluc2.0:GL430520:156780:157908:-1 gene:ENSMLUG00000023229 transcript:ENSMLUT00000028804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTRDAILDALEELTADELKKFKLKLLSVHLRDGYGRIPRGALLPMDAVDLADKLVSCY
LEAYAAELTAQVLRDMGMQDTAERLQAPARARGSGAGPAGIQASPPQVPAIPAPHFVDRH
REALIQRVTDVNGVLDALYGSILREEQYQAVRAEATNPDKMRKLFSFAPAWNLACKDRFL
QALRVTQPYLVEDLERS
Download sequence
Identical sequences G1Q4C0
ENSMLUP00000018553 XP_006106110.1.53796 ENSMLUP00000018553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]