SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018714 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018714
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 2.28e-36
Family Rap30/74 interaction domains 0.000000893
Further Details:      
 
Domain Number 2 Region: 173-240
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-22
Family DNA-binding domain from rap30 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018714   Gene: ENSMLUG00000023658   Transcript: ENSMLUT00000030355
Sequence length 247
Comment pep:putative scaffold:Myoluc2.0:GL429858:2398863:2399606:-1 gene:ENSMLUG00000023658 transcript:ENSMLUT00000030355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTRVWLVKVPKYLSQQWAKAPGRGDVGKLRIAKNQGRTGVSFTLNE
DLVNIHDIGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAAS
ENYMRLKRLQIESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQC
VLDMLFSAFEKHQYYNLKDLVDITKQPVVYLTEILKEIGIQNVKGIHKNTWELKPEYRHY
QGEEKSD
Download sequence
Identical sequences G1Q4T1
ENSMLUP00000018714 ENSMLUP00000018714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]