SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019004 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019004
Domain Number 1 Region: 207-385
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00066
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-19
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 519-653
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-18
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 
Domain Number 4 Region: 98-209
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000063
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019004
Domain Number - Region: 428-489
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0589
Family Ras-binding domain, RBD 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019004   Gene: ENSMLUG00000030196   Transcript: ENSMLUT00000031316
Sequence length 792
Comment pep:putative scaffold:Myoluc2.0:GL430446:2132:67204:1 gene:ENSMLUG00000030196 transcript:ENSMLUT00000031316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETNKKWCVLEGGFLSYYENDKSTTPNGTINISDVICLAVHKEDFYINTGPIFTFEIYLPS
ERAFLFGAETFQAQRRWTEAIAKQFVPFFAENLTQANYDLIGQLYYKDCHALDQWKKGWF
AMDKSSLCFCLQTQEVQEDRMNLRRLQELTISTMVQNGEKVDILLLVEKGRTLYIHGHTK
LDFTVWHAAIEKAAGTDGNALQDQQLSQNDVPIIVNSCIAFVTQYDKGLGCKYIYQNSGD
PLHVSELLESFKKDARSFKLRAGKHQLQDVTGVLKRFLSDIDDALLTKELYPYWISALDT
QDDKERIKKYGAFISTLSGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQT
RGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLTEVYVE
RKEPDCSIIIRISPVMEAEELTNDMLALKNIIPTPGDLWATFEVIENEELERPLHYTENV
LEQVLRWSSLAEPGSAYLVVKRFLTTDTIRHYNERNALESIKEGALKIKEEPSKILSGNK
FQDRHCVLRDGYLILYKDLKSSKHDKMFPLSSMKFYLGVRKRVKPPTSWGLTAYSEKHQW
HLCCDSLQTQMEWMASVFLAQHENDIRPPAGKQRKRSITKNPKIGGLPLIPIQQEKNATQ
AWRNIESARGELEKLRLHEKRDQEPGDSTLKDRASMVAHCLEHRDDKLRHRARKHRSLYC
LEDTEAETEAFHGQQKGPKGSSKTLGKAEDRNGRATLDADNKLPSQVIRELSVVLQRSRT
LPKELQGEQILQ
Download sequence
Identical sequences G1Q5M1
ENSMLUP00000019004 ENSMLUP00000019004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]