SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019670 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019670
Domain Number 1 Region: 160-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-73
Family Protein kinases, catalytic subunit 0.00000216
Further Details:      
 
Domain Number 2 Region: 34-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.55e-23
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019670   Gene: ENSMLUG00000030484   Transcript: ENSMLUT00000027158
Sequence length 547
Comment pep:putative scaffold:Myoluc2.0:GL429775:11422863:11449190:1 gene:ENSMLUG00000030484 transcript:ENSMLUT00000027158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDMGGLDNLMANTAYLQARKTWEGDSRELQRRRRSLALPGPQSCAPLRQALPPDFHSLC
EQQPIGRRLFRDFLATVPRYRETVAFLEQVQSWELAEGPAKGSSLQALVAAAGGPAPGTH
RLPQPGSEHQPLLRTSGAALVALALAEAMAFLQGQPFRDFLASPFYDQFLRWKVFEMQPV
SDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALLEKEILERI
RSPFIVSLAYAFESKSHLCLVMSLMNGGDLKFHIYSVGTRGLAMSRVVFYSAQMTCGLLH
LHSLGIVYRDLKPENVLLDDVGNCRLSDLGLAMQIQDGRPVTQKAGTNGYMAPEILMEKV
SYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKISKEDLKQRTLKEEVTFQHDNFTEEAKDI
CRLFLAKKPEQRLGSRTNTYDVARFVNIVKISFEESREGMASPEGIPSTCMVFSNKIKGE
GHFSEVRGIEFDDKDKKFFQRFATGAVPIAWQEEIIETGLFKELNDPNRLAGCGEGNSSK
SAVCLLL
Download sequence
Identical sequences G1Q7I7
ENSMLUP00000019670 ENSMLUP00000019670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]