SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020370 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020370
Domain Number 1 Region: 27-75
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000017
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020370   Gene: ENSMLUG00000025561   Transcript: ENSMLUT00000027442
Sequence length 80
Comment pep:putative scaffold:Myoluc2.0:AAPE02071931:1571:1953:-1 gene:ENSMLUG00000025561 transcript:ENSMLUT00000027442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQSSLSVLTGIFLLLCLHLAQPEWRAMDVVKPGHCPEFPLRCPFTMIPLCRRDRICKKD
KKCCFYNCRYQCMVPWESLD
Download sequence
Identical sequences G1Q9I7
ENSMLUP00000020370 ENSMLUP00000020370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]