SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020480 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020480
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.1e-62
Family Cyclophilin (peptidylprolyl isomerase) 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020480   Gene: ENSMLUG00000027857   Transcript: ENSMLUT00000029812
Sequence length 164
Comment pep:putative scaffold:Myoluc2.0:GL430019:245985:246528:1 gene:ENSMLUG00000027857 transcript:ENSMLUT00000029812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPTMYFNIAANGEPLGRVSFELFADKVSKTAENFLALSTGEKGFGYKGSCFHRIIPRL
MCQGGDFTRHNGTGGKFFHGEKLEDENFVLKHTGPGILSMANAGRNTNGFFFICAAKTEW
LDGKHVVFGRVKEGMDIVTARERFGSRNGRTSKKITIADGGQLY
Download sequence
Identical sequences G1Q9U7
ENSMLUP00000020480 ENSMLUP00000020480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]