SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020914 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020914
Domain Number 1 Region: 479-601
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-21
Family SPRY domain 0.0044
Further Details:      
 
Domain Number 2 Region: 46-120
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000505
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 182-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000778
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020914   Gene: ENSMLUG00000030452   Transcript: ENSMLUT00000027432
Sequence length 604
Comment pep:putative scaffold:Myoluc2.0:GL430252:74706:80663:1 gene:ENSMLUG00000030452 transcript:ENSMLUT00000027432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLAFPDMQRVSQPVQDHVPAAQPPAQPSRPPPGQRPLRNSGSLCKFEDQVLCPICLEVFH
SPVTTACGHNFCMTCLQGFWDHQAAEGETLYCPCRESFSSRPRLCKNVTLEEMVTCFTQA
KSPASASSWKLAGPRDVPCDFCGPQKRRALKSCLQCMASLCEKHLRSHSEDQVFRDHQLL
EPWDFKSCLCRKHRKLRGLYCRTEGCCVCGTCLLEEHRNHDTIPLQEERARREVELRQVQ
ANVENQMLMITSDSQKHREQVAFLLKMIQTMRDEVQSCFSGIIQEVKQLQTKVLDFVEKE
EAAALEKLGSSIQQSHNWLLKLEADSIWLRTLLTNPSDQQLEEEFPRLKNFQDCMEPLMG
TSWEEKQSFLQLPQTLAELRSRLVGMGLGFINQLLLQGIKMNSYEVLPPTVDRKTLLKCF
CNLNFDPPGAKEGALPFKGDALRGGNLGGLPGGPFPAGGRLPGFKPGGPQGAGPPAALPK
GRHYWERRRWSNLGGVPGRQLQRSPPPSGRPRGSVVYLLGRNPDSWCLEWDSLRFSVWHN
NTQTVLQGGYHRTLGVALDCGAGCLSFYGVAGGVSLLYRFLASFLEPLYPAVMVSSGALV
TLKQ
Download sequence
Identical sequences G1QB31
ENSMLUP00000020914 ENSMLUP00000020914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]