SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021288 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021288
Domain Number 1 Region: 37-117
Classification Level Classification E-value
Superfamily HMG-box 5.63e-30
Family HMG-box 0.0000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021288   Gene: ENSMLUG00000013015   Transcript: ENSMLUT00000013016
Sequence length 278
Comment pep:putative scaffold:Myoluc2.0:GL429781:12629926:12631079:-1 gene:ENSMLUG00000013015 transcript:ENSMLUT00000013016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYNMMETELKPPGPQQTSGGGGGGGGNSTAAAAAGGNQKNSPDRVKRPMNAFMVWSRGQR
RKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT
KTLMKKDKYTLPGGLLARXLGYAQHPGPNTHGAAQMQPMHRYDVSALQYNSMTSSQTYMN
GSPTYSMSYSQQGTPGMAGLHGLVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLP
GAEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM
Download sequence
Identical sequences G1QC55
ENSMLUP00000021288 ENSMLUP00000021288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]