SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021545 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021545
Domain Number 1 Region: 501-589
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-20
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 2 Region: 263-310,443-500
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000147
Family Second domain of FERM 0.0071
Further Details:      
 
Domain Number 3 Region: 360-402
Classification Level Classification E-value
Superfamily PH domain-like 0.00000652
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000021545
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0207
Family Ubiquitin-related 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021545   Gene: ENSMLUG00000030213   Transcript: ENSMLUT00000025323
Sequence length 614
Comment pep:putative scaffold:Myoluc2.0:GL430612:95356:105883:-1 gene:ENSMLUG00000030213 transcript:ENSMLUT00000025323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMKTATGDYIDSSWELRVFVGEEDPEAESVTLRVTGESHIGGVLLKIVEEINRKQDWS
DHAIWWEQKKLWLLQTHWTLDKYGILADARLFFGPQHRPILLRLPNRRALRLRASFSQPL
FQAVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEEVYDLTKVVLAGGMAPALFRG
MPAHFSDSAQTEACYHMLSRPQPPPDPLLLQRLPRPSSLLDKTQLHSRWLDSSRCLMQQG
IKAGDTLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLLEEIDCTEEEMMVFAALQYH
INKLSQSGEVDEPAGSDPGLDDLDAALSNLEVKLEGSARTDVLDSLTAIPELKDHLRILR
PRKLTLKGYRQHWVVFKETTLSYYKSQDEAPGDPIQQLNLKGDVRGWPGGRGVHRLSXGI
LAFLSLQRAGTGGPGSQPQGPDASAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQ
LPLSEAQLRFIQAWQSLPDFGISYFIVKFKGSRKDEILGIANNRLIRIDLAVGDVVKTWR
FSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELD
EDLFLQLTGGHEAF
Download sequence
Identical sequences G1QCW2
ENSMLUP00000021545 ENSMLUP00000021545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]