SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021760 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000021760
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0152
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021760   Gene: ENSMLUG00000027268   Transcript: ENSMLUT00000030255
Sequence length 127
Comment pep:putative scaffold:Myoluc2.0:GL429822:4419027:4429813:-1 gene:ENSMLUG00000027268 transcript:ENSMLUT00000030255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFAQEIRLSKRHEEIVSQRLKLLQQMESKFEDQNKEKASQIQAAEAAFKRNLSLLKD
IEAAEKSLQTWSHPLPPPEVVSLETLYWASVEEYIPKWEQFLLGRAPYPIGVENQNEAEN
TIRNKAQ
Download sequence
Identical sequences G1QDH7
ENSMLUP00000021760 XP_006089105.1.53796 XP_014311602.1.53796 XP_014311603.1.53796 XP_014311604.1.53796 XP_014311605.1.53796 XP_014311606.1.53796 XP_014311607.1.53796 ENSMLUP00000021760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]