SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022148 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022148
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily HMG-box 1.96e-24
Family HMG-box 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022148   Gene: ENSMLUG00000022392   Transcript: ENSMLUT00000023617
Sequence length 274
Comment pep:putative scaffold:Myoluc2.0:GL430504:51975:55046:1 gene:ENSMLUG00000022392 transcript:ENSMLUT00000023617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGPKQPGAAVAPAGGKAPAQHGGFVVAVKQERGEGPRASDKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL
DEAEREKQQYIKELRAYQQSEAYKMCTEKIQEKKIKKEDSGSGLMNTLLNGHKGGDCDGF
STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQNAVLQRHTQNMSSARERLEQELAL
EERRTLALQQQLQAVRQALTASFASLPVPGAETP
Download sequence
Identical sequences G1QEL5
ENSMLUP00000022148 ENSMLUP00000022148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]