SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022326 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022326
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Ferritin-like 3.45e-31
Family Ferritin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022326   Gene: ENSMLUG00000029542   Transcript: ENSMLUT00000030456
Sequence length 172
Comment pep:putative scaffold:Myoluc2.0:GL429998:1958737:1960441:-1 gene:ENSMLUG00000029542 transcript:ENSMLUT00000030456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQPVSKECGVAINYVASYELHISNAYLSMACCYIDDAREPIFSGFFEDQAEVKREHGKQF
LRYLVGCGNTICLPVIKRPEVDNWQTGIKALEYALQLENQLSQLLIDLRVTAAANNDNNL
LNFMKRFLDKQRKDINHLQCQIVCYHILEKEVQEQTSQNKRPLKNTATRKMQ
Download sequence
Identical sequences G1QF43
ENSMLUP00000022326 ENSMLUP00000022326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]