SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AB08526.1 from Alternaria brassicicola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AB08526.1
Domain Number 1 Region: 405-563
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-22
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 296-393
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000018
Family Rhamnogalacturonase B, RhgB, middle domain 0.03
Further Details:      
 
Domain Number 3 Region: 83-276
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000016
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AB08526.1
Sequence length 620
Sequence
MSALKLLGLAALAAAAPVEERAKKPKSFLKELGNSTWVIGNEIWNVTQNRQYADKLWYQG
KDRVGDAVGHYVSYNGAASDLNWTSAAIVDSDTDYINVKFTAKEGDFHWVIYDNLPGAYQ
YFVNRALPTLGEFRTLWRLDNTSFPRGHTNVRDGVLPALEEYLQATNVQDETWQKADGTF
LTKYDWSGFVREQTYYGVYGDEVGSWYLNPGKDYYNGDHLKQELMVHRESRTGDAVQLNM
IHGTHYQAIARDSFSDGKIWGPWLWYLNDGSKDDAAARWEKEEAAWPYKWFENKPYQSRG
KMQGKLLLSDGRPAAGAAVFLGDNRNTTVSTLDQGQNYYYTTYADEDGKFDIGDIRTGTY
ALYAWGNGGAIGDVTTNFTQNDVEIREGKNTNLKEMTWKITDGEKRIFQIGDFDRKTDGF
KLADPAHPYEHDRISRCPANLTYTVGTSSSLDWCFGQSALGTWSVLFPSKSTSAAKLTVS
LAGFSQGSSCDILLNDVKVGNITSASLLNSQDTYRGATRAGEWRLLELPIAEGALKSEGN
NRLDIRVTRSTRWRGWLWDSLVLDQTMRVLESVISVTTRRDTTARLPGFWVVAELFTFKY
APVAYSAVPLYVFVVEGTLC
Download sequence
Identical sequences AB08526.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]