SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AB10029.1 from Alternaria brassicicola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AB10029.1
Domain Number 1 Region: 21-335
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-62
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 441-659
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-18
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.093
Further Details:      
 
Domain Number 3 Region: 339-435
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000883
Family Rhamnogalacturonase B, RhgB, middle domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AB10029.1
Sequence length 661
Sequence
MRSTVATAAVLLLPSTSWAFLNASQNNQSLTIANDRLVASVSKTRGHVNVLTLDGQNLLG
SENGNTGVGPYLDCYCTPSGFWTPGRGSNVQYQLFSGNDSTGTPYGGISMGETYAPTGQR
LEQYWFLREGETGLHTFSRVVYNNKTTPFLRNLQEFRTLFRPNHEPALFTHFVTNEKFAA
PRPNTEGQVTVQDATWYLPNKESPYVEGVGDYFTKYTFQDTWRDHKAHGMYADGTGSANG
STYGAWLVHNTIETYFNGPVHSDLVVDGIVYNYMVSNHHGLQTPNITDGFDRTFGPQYFH
FNSGGSLEELRQDAEQYGLRPEWNAEFYDSIAKHVPNLVPTSGRGTLNAKINLPAGAKNP
IAILTESGHNFQDNVFDTKAYQYWEDISTDGKVTIPRVKAGNYRLTVYADGIFGDYYQDD
VSVSAGEETSIVATWTPESAGKELFRIGTPDKSSGEYRHGYAQSPTNPLLTEEYRLYWGA
FDFVDEFPEGVTYKVGRDDESQALNYVHWAVYGGKANYERPEPVPDHPYNWTILFDAQAK
ELSNKTTATFTVQLAGAKTAAGNTDVFNASEPYSNLPFTVNVNGEDLEPWIIPYNQSSSC
AVRSAVICYNLAHKFLFPTSMLKDGENSLILSLPYNGTNFENALLPEAVYVQYDAMRLEV
K
Download sequence
Identical sequences AB10029.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]