SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AB01013.1 from Alternaria brassicicola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AB01013.1
Domain Number 1 Region: 466-573
Classification Level Classification E-value
Superfamily PH domain-like 0.000000253
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 
Domain Number 2 Region: 366-434
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000475
Family Ras-binding domain, RBD 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AB01013.1
Sequence length 859
Sequence
MATETMPSSAAATPKMSRYRSVRRAQEQQTRQPGQYDQDHTSPAVPAMPPMPPMPESLPH
NDAPISRSMSRYHRRPTTSHAASPNPPPLRLDTMPNAPPPLPAQLPPSTSRSRALSSPYQ
SSHAANTGQRRPRTAKPRAEASPPVSNVPRQQSLRGDDGAREVLQREKERQRQLKEKYEA
EAHAQRQAKQAELDRIEKQRQEEEEAARLEAQREWEEAEALRRQREEQKAEQERGRRLQK
AETQKVLQQREESIRKAKAKEKERQAILANLEQKARKAPSSSPPISPPRQQEVGFGMFKR
RKDEALGLDAPVQQSTPPQLSLDLDNQEEETIRPGGGGVVLGIDAPTSAVNAGDRRVKVV
CNEKRILLPVTPTTTPLDLIKSAATVLADPIDVRTAVICEFFTKVSITRPLRNYEYVRDV
MNSWDYDNQNELTIIDSDVDGIDQDSLLSYKVPDTRPEGASCFIQYSSRPGKWSKRFLVL
RPDGQLVMAKNEKTKEKDQENICTLTDYDIYSVTQSKLARVKPPKKICYAVKSMQKSNIF
ADESQYVHFFCTNDRDTANTFYTALQTWRSWYLKHQKGEGLKKKTTAQRNVSGSAGATQA
SSHARGESVGSHYQLGAFSSLLDMDSFNKTLDEIEVHKPGEFPDDKPLSKLDSSAMHARM
KSIRVKRPPPTAFNKSGLAAEIPPPPPPTARRRSIEQQGDEAFASSGLLGRSYTQRQAAL
QAREQSGPFTEGPSLLSSTGIKHSTSVHSNHHRRTSSDLQRSASKRVPGMPEPLVDLTPQ
YKPPPQHLNKGKGYNPGAGAGLLVESATSIEEAIKVPSSTDWRAGRPGTSRAAHSAYVLV
ATTYAFAQGAGWSLWQRIH
Download sequence
Identical sequences AB01013.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]