SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AB05726.1 from Alternaria brassicicola

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AB05726.1
Domain Number 1 Region: 695-890
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-69
Family Sec7 domain 0.0000049
Further Details:      
 
Domain Number 2 Region: 161-260,449-536,970-1058,1224-1309,1353-1375,1408-1571
Classification Level Classification E-value
Superfamily ARM repeat 3.1e-19
Family MIF4G domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AB05726.1
Sequence length 1922
Sequence
MADTDPPPAQKEEVEKPDHMEEEKETHPYNTGGEEESGSDSESEQASEEGEDTSFPAPEA
PQEEADTSTSTPTSTAAQALNVPDGGDAPRSSEQIFDHRLPIESRPRTDSQSTAATTATR
PSTRSSLVFVVTALETIAASKDARKNKKLGDSTNAALSAIKNEGDPARINPEVLFEPLQL
ASEAPSIPVSITALDCIGKLISYSYFSVPAEPRADNSEVPPLIERAIDTICDCFQGEATA
PEVQLQIVKSLLAAILNDKIVVHGAGLLKAVRLTYNIFLLSKSSANQQVAQGALTQMVGT
VFERVKTRLAVKEARLNLSGSSLNGKGQSEESVQQDEGSSEDINGAEASGEDEKAEHDAE
NAEPSDKAVDRHTGPKITLQSFENNMSFNDDRIHDNAPTLVTRIKGKAGSRHVSGQESSP
HVNTEEEEEDEIFVKDAYLVFRAIGSDEPTSFIQAVKQYLCLSLSRNGASSVKQVFEVAC
EIFWQMLKYLRISLKKEVEVFLKEIYLATLDKRSAPAFQKQYILTIFGRLAADPRALVEI
YLNYDCDRTALDNMFQRVVEHLSKISSNPVTITAMQQQAYQDQREKQARQMDWQSRGTLP
PSLTTVSMNSSHETEHGYPQEYAMKQESLEALVEILRSLVNWAQQALPENTKQNNPDLRP
SLDDLRVSTDTRLAAESPMVGADSGTVTPLAEDDYSQLEKAKQRKTALTNALRQFNYKPK
RGLKTLIAEGFIPSNKPEDIARFFLDNDQIDKTALGEFLGEGDPENIAIMHAFVDLMDFT
KTRFTDALRRFLQSFRLPGEAQKIDRFMLKFAERYITGNPNAYANADTAYVLSYSVIMLN
VDQHSKKMKGPRMTPADFIKNNRGINDSADLPDEYLQGIFDEISQNEIVLNTEQEAAADK
GLLNQQPTGGLSSIGQVLTGGARDLQREAIVQASEAMANKTEQLYKQLLRAQRRTAAALP
VSKFIPASSSKHVGPMFEVSWMPILTALSGQAQDHNIEIVRLCIEGIKLAIRISCLFDLD
SSRQAFVAFLARFTNLYNVSEMKARNMEALKALIEIAQTEGNLLRESWREVLTCVSQLDR
FQLISSGIDERAVPDVLKSSSGTAQSRKNLSVPANRPRPKSQASTMSFHSEVAEESRSTD
IVRGVDRIFTNSANLSGEAIVDFVKALVQVSWREIQSSGQSESPRTYSLQKLVEISGYNM
TRVRFEWTNIWQVLGAHFNEVGCHTNTNVVYFALNSLRQLSMKFMEIEELPGFKFQKDFL
KPFEHIINNTNVVSVKDMVLRCLIQMIQARGENIRSGWKTMFGVFTVAAREPYEGIVNLA
FENVTQVYNTRFGVVISQGAFADLIVCLTEFSKNFKFQKKSLQAIELLKSSVPKMLRTPE
CSLSARAGYLKDSEKGSSIPKQPSRQTQEEQFWFPVLFAFHDVLMTGEDLEVRSRALQYL
FDTLISYGGDFPRDFWDMLWRQLLYPIFMVLKSKSEMTKVLNHEELSVWLSTTMIQALRN
MIKLFTHFFDSLEYMLDRFLDLLALCICQENDTLARIGSNCLQQLILQNVQKFQADHWSQ
IVKAFVDLFQRTEATALFSAATSGSSTQPASTNGTGNTSDLTTPAGEGPPGELSLQTPAE
EPKMDNALGINGLSGARRPSLVTSDSASISGGVEQRMPSPLPKRQTQELEDYRPDDQNLQ
QPPVVVTAARRRFFNQIITKCVLQLLMIETVQELFTNEAVYEKIPSDELLRLMAVLKKSY
HFAKRFNANRDLRSRLFREGFMKQPPNLLKQESGSASVYVSILFRMYHDTSNDRAASRAD
TEAALIPLCEDIIASYVDLDEETQQRNIVTWRPVVVTVLDGYTGLPDTDFEKNVDIFAPL
VVGLLGTEMAPDVQRSVQALVGRIFETKLGMEKQPLMPAISRSPRGSFVGSPSQRRASKG
GR
Download sequence
Identical sequences AB05726.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]