SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|315035|fgenesh1_pm.C_scaffold_2000068 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|315035|fgenesh1_pm.C_scaffold_2000068
Domain Number 1 Region: 74-230
Classification Level Classification E-value
Superfamily IpsF-like 1.7e-58
Family IpsF-like 0.00000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|315035|fgenesh1_pm.C_scaffold_2000068
Sequence length 231
Sequence
MATSSTQLLLSSSSLFHSQITKTPFLLPATKIYLRRPKQSLSLSCRPSISVLAASSAVDV
NESATSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVLLHCVVD
AILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKIS
PHKETIRSNLSKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
Download sequence
Identical sequences D7KSX3
59689.fgenesh1_pm.C_scaffold_2000068 XP_002886373.1.15461 jgi|Araly1|315035|fgenesh1_pm.C_scaffold_2000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]