SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|327853|fgenesh1_pm.C_scaffold_7000080 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|327853|fgenesh1_pm.C_scaffold_7000080
Domain Number 1 Region: 46-259
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.67e-22
Family BAR domain 0.05
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000341
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|327853|fgenesh1_pm.C_scaffold_7000080
Sequence length 373
Sequence
METIRKQASKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEEFHRHQKLEKLYLSTRSA
KHFQRDIVRGVEGFIVTGSKQVEIGTKLCEDSRRYGSENTCTSGNTLTRASLSFANARAQ
MEKERGNLLKTLGTQVAEPLRAMVMGAPLEDARHLTQRYDRMRQEAEAQTIEVSKRQAKV
RENPGNPELVMKLESAEAKLQDLKSNMTILGKEAASAMAGVEDQQQNQTLQRLITLVEAE
RNYHQRILEVIERLEGEMRFEQQRIEAPQNPQVENITFWPPPSYEEANDGVNASQMHNGT
SDAMGYFLGEVMFPYQAESDFELTLSVGEYVVIREVVSSGWAEGECKGKAGWFPYDYIER
RDRVLATKVIEVF
Download sequence
Identical sequences D7MGA5
jgi|Araly1|327853|fgenesh1_pm.C_scaffold_7000080 XP_002866827.1.15461 59689.fgenesh1_pm.C_scaffold_7000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]