SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|470078|fgenesh2_kg.1__32__AT1G01960.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|470078|fgenesh2_kg.1__32__AT1G01960.1
Domain Number 1 Region: 605-796
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-76
Family Sec7 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 369-540,912-973,1125-1293,1320-1384,1412-1648
Classification Level Classification E-value
Superfamily ARM repeat 1.25e-18
Family HEAT repeat 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|470078|fgenesh2_kg.1__32__AT1G01960.1
Sequence length 1750
Sequence
MASTEVDSRLGRVVIPALDKVIKNASWRKHSKLAHECKSVIERLRSPENSSPVADSDSGS
SIPGPLHDGGAAEYSLAESEIILSPLINASSTGVLKIVDPAVDCIQKLIAHGYVRGEADP
TGGPEALLLSKLIETICKCHELDDEGLELLVLKTLLTAVTSISLRIHGDSLLQIVRTCYG
IYLGSRNVVNQATAKASLVQMSVIVFRRMEADSSTVPIQPIVVAELMEPMDKSESDPSTT
QSVQGFITKIMQDIDGVFNSANAKGTFGGHDGAFETSLPGTANPTDLLDSTDKDMLDAKY
WEISMYKSALEGRKGELADGEVEKDDDSEVQIGNKLRRDAFLVFRALCKLSMKTPPKEDP
ELMRGKIVALELLKILLENAGAVFRTSDRFLGAIKQYLCLSLLKNSASNLMIIFQLSCSI
LLSLVSRFRAGLKAEIGVFFPMIVLRVLENVAQPDFQQKMIVLRFLDKLCFDSQILVDIF
INYDCDVNSSNIFERMVNGLLKTAQGVPPGIVTTLLPPQEASMKLEAMKCLVAVLRSMGD
WVNKQLRLPDPYSAKIIEIDDRNLEEGSHPVENGKGDGGHGGFERSESQSELFSGTSDAL
AIEQRRAYKLELQEGISIFNQKPKKGIEFLIKANKVGDSPEEIAAFLKDASGLNKTLVGD
YLGEREDLSLKVMHAYVDSFEFQGMEFDEAIRAFLRGFRLPGEAQKIDRIMEKFAERYCK
CNPKAFSSADTAYVLAYSVILLNTDAHNPMVKSKMTADGFIRNNRGIDDGKDLPEEYLRA
LYERISRNEIKMKDDGLGLQQKQPTNSSRLLGLDTILNIVVPRRGDDMYMETSDDLIRHM
QERFKEKARKSESVYYAASDVVILRFMVEVCWAPMLAAFSVPLDQSDDEVITTLCLEGFH
HAIHVTSVMSLKTHRDAFVTSLAKFTSLHSPADIKQKNIEAIKAIVKLAEEEGNYLQDAW
EHILTCVSRFEHLHLLGEGAPPDATFFAFPQTESGNSPLAKPNSVPAVKERAPGKLQYAA
SAVIRGSYDGSGVAGKASNTVTSEQMNNLISNLNLLEQVGDMSRIFTRSQRLNSEAIIDF
VKALCKVSMDELRSPSDPRVFSLTKIVEIAHYNMNRIRLVWSSIWHVLSDFFVTIGCSDN
LSIAIFAMDSLRQLSMKFLEREELANYNFQNEFMKPFVVVMRKSGAVEIRELIIRCVSQM
VLSRVDNVKSGWKSMFMIFTTAAHDAHKNIVFLSFEMVEKIIRDYFPHITETETTTFTDC
VNCLVAFTNCKFEKDISLQAIAFLQYCARKLAEGYVGSSQRRNPPSSPQSGKSGKQDSGK
FLESDEHLYSWFPLLAGLSELSFDPRAEIRKVALKVLFDTLRNHGDHFSLSLWERVFESV
LFRIFDYVRQDVDPSEDDSTDQRGYNGEVDQESWLYETCSLALQLVVDLFVNFYKTVKPL
LKKVLMLFVSLIKRPHQSLAGAGIAALVRLMRDVGHQFSDEQWLEVVSCIKEAADATAPD
FSYVTSEELMEDVSNEDETNDNSNDAMRRTNRQLQAVVADAKSKASIQIFVIQAVTDIYD
MYRMSLTANHMLMLFDAMHGIGSNAHKINADLLLRSKLQELGLSPESQEAPLLRLENESF
QTCMTFLDNLISDQPVGYNEAEIEAHLISLCREVLEFYINISCSKEQSSRWAVPSGSGKK
KELTARAPLVVAAIQTLGNMGESLFKKNLPELFPLIATLISCEHGSGEVQIALSDMLQTS
MGPVVLRSCC
Download sequence
Identical sequences D7KP56
jgi|Araly1|470078|fgenesh2_kg.1__32__AT1G01960.1 XP_002889344.1.15461 59689.fgenesh2_kg.1__32__AT1G01960.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]