SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|491189|fgenesh2_kg.7__622__AT4G34660.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|491189|fgenesh2_kg.7__622__AT4G34660.1
Domain Number 1 Region: 44-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-22
Family BAR domain 0.071
Further Details:      
 
Domain Number 2 Region: 298-359
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|491189|fgenesh2_kg.7__622__AT4G34660.1
Sequence length 368
Sequence
MDAIRKQASRLREQVARQQQAVFKQFGGGGYGSGLADEAELNQHQKLEKLYISTRAAKHY
QRDIVRGVEGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGRARAQMEK
ERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQEAEAQATEVARRQAKARES
QGNPDILMKLESAEAKLQDLKSNMTILGKEAASALASVEDQQQKLTLERLLSMVESERAY
HQRVLQIIDQLEGEMVSERQRIEAPSTPSSADSMPPPPSYEEANGVFASQMHDTSTDSMG
YFLGEVLFPYHGVTDVELSLSTGEYVVVRKVTGSGWAEGECKGKAGWFPYDYIERRERVL
ASKVSEVF
Download sequence
Identical sequences D7MDJ8
59689.fgenesh2_kg.7__622__AT4G34660.1 jgi|Araly1|491189|fgenesh2_kg.7__622__AT4G34660.1 XP_002867108.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]