SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Araly1|918421|scaffold_801821.1 from Arabidopsis lyrata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Araly1|918421|scaffold_801821.1
Domain Number 1 Region: 901-1046
Classification Level Classification E-value
Superfamily SET domain 2.35e-43
Family Histone lysine methyltransferases 0.0069
Further Details:      
 
Domain Number 2 Region: 221-330
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-16
Family PWWP domain 0.0032
Further Details:      
 
Domain Number 3 Region: 613-678
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000204
Family PHD domain 0.0099
Further Details:      
 
Domain Number 4 Region: 418-477
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000332
Family PHD domain 0.0056
Further Details:      
 
Weak hits

Sequence:  jgi|Araly1|918421|scaffold_801821.1
Domain Number - Region: 718-755
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0206
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Araly1|918421|scaffold_801821.1
Sequence length 1049
Sequence
MIIKRKLKTRMSSLKRCNSTNEEDDRAKKKRKVNFNGGGDYYYPLNLLDEIGVGIVPGKN
GFSVSLCKEVEVVEVEEEIKSKRLVADTSQRGRDRMGEVSRPPLVRTSRGRVQVLPSRFN
DSVIENWRKDSKSSGEEREGEIEEEACRKEKVKAKFTPRNYKYSSSALCEERDDEDKCEE
IGRYGNSYEMKKHMMSSRTSLASLQEQRYVDDEPRPKKEGVYGPEDFYSGDLVWGKSGRK
EPFWPAIVIDPMTQAPELVLRSCIPDAACVMFFGHSGTENERDYAWVRRGMIFPFVDYVD
RFQEQSELRGCNPREFQMALEEALLADQGFTEKLMQDIHLAAGNQSFDDSVYRWIEEAAG
SSQYLDHVAPNQDMKKYRNPRACVGCGMILSLKMAQKMKALIPGDQLLCKLCSRLTKPKQ
VCGICKKIWNHLDSQSWVRCDGCKVWIHSACDQISHKHFKDLGETDYYCPTCRTKFNFEL
SDSEKQDSKSKLGKNNAPMVLPDKVIVVCSGVEGIYFPSLHLVVCKCGSCGPERKALSEW
ERHTGSKAKNWRTSVKVKSSKLPLEEWMMKLAEFHANATAAKPPKRPSIKQRKQRLLSFL
REKYEPVNVKWTTERCAVCRWVEDWDYNKIIICNRCQIAVHQECYGTRNVRDFTSWVCKA
CETPEIKRECCLCPVKGGALKPTDVETLWVHVTCAWFQPEVCFASEEKMEPALGILSIPS
SNFVKICVICKQIHGSCTQCCKCSTYYHAMCASRAGYRMELHCLEKNGRQITKMVSYCSY
HRAPNPDTVLIIQTPSGVFSAKSLVQNKKKTGSRLILANREEVEESAAEDTIPIDPFSSA
RCRLYKRTVNSKKRTKEEGIPHHKGGPRHHPSAAIQTLNAFRHVAEEPKSFSSFRERLHH
LQRTEMDRVCFGRSGIHGWGLFARRNIQEGEMVLEYRGEQVRGIIADLREARYRREGKDC
YLFKISEEVVVDATEKGNIARLINHSCMPNCYARIMSVGDDESRIVLIAKTTVASGEELT
YDYLFDPDEPDEFKVPCLCKSPNCRKFMN
Download sequence
Identical sequences D7MSY3
jgi|Araly1|918421|scaffold_801821.1 59689.scaffold_801821.1 XP_002864242.1.15461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]