SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320450463|ref|YP_004202559.1| from Thermus scotoductus SA-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320450463|ref|YP_004202559.1|
Domain Number 1 Region: 277-446
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.44e-46
Family MgtE membrane domain-like 0.000000137
Further Details:      
 
Domain Number 2 Region: 133-265
Classification Level Classification E-value
Superfamily CBS-domain pair 1.07e-39
Family CBS-domain pair 0.000000397
Further Details:      
 
Domain Number 3 Region: 8-130
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 3.4e-25
Family MgtE N-terminal domain-like 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320450463|ref|YP_004202559.1|
Sequence length 449
Comment magnesium transporter [Thermus scotoductus SA-01]
Sequence
METTLSPLRQALQEGDTLKLQRLLEETHPQDLLAVWDDLEGEHRYVVLTLLPKDRAAEVF
ANLPAEEQAEYLKTLPPWRVRELLEELSLDDLADALQAVEEEDPDLARRLKEALDPETRA
EVEELTQYEEDEAGGLMTPEYVAVREGMTVEEVIRFLRRAAPDAETIYYIYVVDEAGRLK
GVLSLRDLIVADPKTKVAEIMNPKVVFARTDTDQEEVARLMADYDFTVLPVVDEDGVLVG
IVTVDDVLDVLEEEATEDIHRMAAVDVPDLVYSQASPIALWMARVRWLVILILTGMVTSS
ILQGFENLLEAATALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVMAKETL
VGSLLGLTLATLLLGKVFLDGHAALAPAVGLALFLLVLFANLVGAMLPVVLRRLGVDPAL
VSNPLVATLSDISGLLIYLSVARLLLDLG
Download sequence
Identical sequences A0A0N0ZRJ0 E8PJQ5
WP_015717281.1.51029 WP_015717281.1.74984 gi|320450463|ref|YP_004202559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]