SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320450825|ref|YP_004202921.1| from Thermus scotoductus SA-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320450825|ref|YP_004202921.1|
Domain Number 1 Region: 115-536
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.2e-95
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000311
Further Details:      
 
Domain Number 2 Region: 2-124
Classification Level Classification E-value
Superfamily Cytochrome c 8.6e-21
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320450825|ref|YP_004202921.1|
Sequence length 536
Comment nitrite reductase [Thermus scotoductus SA-01]
Sequence
MKRTLGLLGSLLLAALALAQAPAPLSPAEKEEAAKIYFDRCAGCHGVLRKGATGPALDPK
KMAEKGVEYLKAVIFGGLPGGMPDWGRQGILKEKDIELVARFLLEQPPAPPVPTFEEIKK
TWKVHVPPEKRPTKPLHNRNWQNFFGQVLRDTGQVAIIDGDKKELVSIVPTGFATHILRS
SATGRYFMAIGRDGKASLIDLWMNPPQVVAESKPCLDARSIESSKFKGYEDKYAVVGCYW
PPTMVVLDGLTLEPLKMVSTISYAKGAGELVMEARVAAIVASHFNPEWIVNLKESGQTWL
VDYSNLHKKGRPLPITMIDTNLFLHDGGWALKRYFIVAANALNKLIVIDTKTREFAAEVE
AGVRPHPGRGSNWEHPTYGPVWATGNIGSPEVTVVGVDPEKHPQYAWKVVKRITLPYTGN
LFIKTHPNSPWVIVDFPMSPSPQAAASLCAIDKRKLEVAKCWEVPGAQELKARMVHPEFN
KGGTEIWVSAWGSKDTPTFIVVYDALTLKEKARITGDWVRTPTGKFNVYNTAYDIY
Download sequence
Identical sequences E8PLV3
gi|320450825|ref|YP_004202921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]