SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320451273|ref|YP_004203369.1| from Thermus scotoductus SA-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320451273|ref|YP_004203369.1|
Domain Number 1 Region: 50-172
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 1.96e-41
Family Insert subdomain of RNA polymerase alpha subunit 0.000000947
Further Details:      
 
Domain Number 2 Region: 2-50,173-227
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 4.91e-32
Family RNA polymerase alpha subunit dimerisation domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 250-312
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 0.0000000000000222
Family C-terminal domain of RNA polymerase alpha subunit 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320451273|ref|YP_004203369.1|
Sequence length 313
Comment DNA-directed RNA polymerase subunit alpha [Thermus scotoductus SA-01]
Sequence
MLESKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIED
VLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMQTTTLVLKAEGPKVVRAGDFVVPPDA
EILNPDLTIATLDKGGKLYMEVRVDRGVGYVPAERHGIKDRINSIPVDAIFSPVRRVAFQ
VEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILKEHLSYFANPQATALPAPEPAS
VERAEGEEDLDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEI
REALAKKGFALKE
Download sequence
Identical sequences E8PP95 W2U672
gi|320451273|ref|YP_004203369.1| WP_015718084.1.74984 WP_015718084.1.96217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]