SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313116868|ref|YP_004037992.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313116868|ref|YP_004037992.1|
Domain Number 1 Region: 480-578
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000196
Family Staphylococcal nuclease 0.006
Further Details:      
 
Domain Number 2 Region: 176-229
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.000000602
Family Staphylococcal nuclease 0.0093
Further Details:      
 
Domain Number 3 Region: 26-144
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000000687
Family Class I glutamine amidotransferases (GAT) 0.06
Further Details:      
 
Domain Number 4 Region: 985-1037
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000275
Family Type I dockerin domain 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|313116868|ref|YP_004037992.1|
Domain Number - Region: 348-464
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000103
Family DJ-1/PfpI 0.093
Further Details:      
 
Domain Number - Region: 833-965
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000628
Family Cellulose-binding domain family III 0.023
Further Details:      
 
Domain Number - Region: 694-814
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.000961
Family STM3548-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313116868|ref|YP_004037992.1|
Sequence length 1039
Comment ABC transporter [Halogeometricum borinquense DSM 11551]
Sequence
MLVDDDQDFSTGNEEFILNVWDDLADGGTVLWDEGHGQYYNLARFSAFETYAESNGYDVQ
ATSDLTADLSGASAVVITSPSDAFSDAELSALSSFVAEGGAVFLHHQSDFDDFDETDNLN
TIASELGLSFRFNDAQVTDATNNTGVNYVPTTSQFNDEFPYFEDRDGISSGSELDPSKRY
TVDVISVADGDTFDVEFDDGTEESIRVLGIDTPESASASDAERPEEWEGLSYEETTDGVR
SVSTLNFYSATTLLAADGSPYTDGETTAVLAPEGSAVNDEDGNGDAVTYPDSAIPLAAID
GNVAAVSSALVNDASLDSDASNFVLNVWDDLTGGDATVAWYDNGQFDGFDSFSNFVSNAE
SAGYTVSTVDSLDADLSGIDLVVCSQPQQPSDTELSALTTFVEDGGAVYAMGKSDYEDYD
NTTASNDILDAAGAPFRFNDAQVVDSEGNFEFSTSRFDSSFPYFGGGEDNSSSDVQYPYL
VNWANQATSVAEEELSGKTIEIYFDENEGVRDPFDRVLAYADYDATGDGNRDTTYNAKMI
EDGLARVYGSTLSRHDEFWDLEHTARTEGRGLWNESDISTAAEIRNSAVQELYFPDAAAV
TGSASLDGRVPVASEDGTPLVGVDADAGVALVGSPFIDESYEADEGFAADTSGYGNFTFL
SNLIDSLSDKNGDVLIDGGHGQFGAGYALSSEDAAYYQRYLEGVGLTLEQVNTAYSERLD
DARAIIVTTPVSEFTADEVAALSDFAANDGAVVLLGSAAAPGSTTANLERLASELGTDLR
LGSAVTDGSSNVNGNASIPVTTNFDDAFSLFDSYEPNTDGSGGSDGDDGESPTLSVSFPE
NGGVGGTVPAELSLSDAPDGLAGFDVTVSVDDAAVASIESATVADAFPSGVTEVSVADDD
SSVTLAASDIEDAVEGGAANVSLATLSVGLQSAGETGVTLSVNALDSDADGSAIDAATDT
GVVTVADIARIGDNDLPTDPDGDGLYEDMNGNGEADFEDVVVFFEHRDSDAVQSNADSFD
FNGNGRVDFDDINTLFDEI
Download sequence
Identical sequences E4NVH2
gi|313116868|ref|YP_004037992.1|NC_014731 WP_013440742.1.94995 gi|313116868|ref|YP_004037992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]