SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313117346|ref|YP_004044329.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313117346|ref|YP_004044329.1|
Domain Number 1 Region: 350-402
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000265
Family Type I dockerin domain 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|313117346|ref|YP_004044329.1|
Domain Number - Region: 173-241
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0706
Family Rhamnogalacturonase B, RhgB, middle domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313117346|ref|YP_004044329.1|
Sequence length 413
Comment dockerin-like protein [Halogeometricum borinquense DSM 11551]
Sequence
MSIRRTTEVIQMKQTFTAVTAALLVLAPIALAIGPGAVAAQQDPYTVEVVAPDDFSTNGN
QTLTVRVTNNADDAFLNPVVEVPISSPLSLPAGATDTVYADGDPSNTREAAVQDSTFQTG
DALVISGANIDAGETRTYHFNVTVDTPGSTTVSADVRPLYNTDQNVRASTSMTALGTGTV
SANVVDTDGNAVSNADVSIDGNAVGSSVSETVLEGEHTVSVSGLDGDYPSFTFDTAVGGD
NSVTFVKQDEKTIQPIAYTSDETNIVVSSTSRTEGSAVSPVNTTVSFTFSKDSGTAVYEV
QEPSVATKGDGTVSTDGNLVSESMVDGDKRLEIKPTGATTQVDLEYEGYELGNVNRDDTV
DATDASAVSADVAKGQSPEYADVNDDGRVSAIDAMFIAQYAADNRTPDYSGVQ
Download sequence
Identical sequences E4NUE8
WP_013446582.1.71935 WP_013446582.1.94995 gi|313117346|ref|YP_004044329.1| gi|313117346|ref|YP_004044329.1|NC_014735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]