SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313117446|ref|YP_004044429.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313117446|ref|YP_004044429.1|
Domain Number 1 Region: 22-239
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.00000000000222
Family ETX/MTX2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313117446|ref|YP_004044429.1|
Sequence length 272
Comment hypothetical protein Hbor_32360 [Halogeometricum borinquense DSM 11551]
Sequence
MEIIEMIEDWTQEWMNQRRGGNNWDWNHTNPTFKNYYDSYGLDLQPTSGDYQIESQSTSS
KSVFTSTYGPNDYPTEASFQHTHTQEDRFSWSLEDSLSYGEDVSIEVGVPDIFSANVGNH
YEISLTTTQEQTRSNQTEWTQHQTFHLPEDETARVEMIVDVIEARAKKDVSVVATGSVAA
GLNHTWNGHYFWFLPIGELADEFSTHPGVKVKDNHQVEFTTKLNMTGNAGVNSRIQIKRE
DKEGMTTVQTFNHIHHPEQLLTGAQTQKPTAD
Download sequence
Identical sequences E4NUP8
WP_006056172.1.71935 WP_006056172.1.94995 gi|313117446|ref|YP_004044429.1| gi|313117446|ref|YP_004044429.1|NC_014735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]