SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313125044|ref|YP_004035308.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313125044|ref|YP_004035308.1|
Domain Number 1 Region: 12-96
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.77e-33
Family Imidazole glycerol phosphate dehydratase 0.00022
Further Details:      
 
Domain Number 2 Region: 97-188
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.46e-30
Family Imidazole glycerol phosphate dehydratase 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313125044|ref|YP_004035308.1|
Sequence length 203
Comment imidazoleglycerol-phosphate dehydratase [Halogeometricum borinquense DSM 11551]
Sequence
MSDDADSDATSRTAAVSRETAETTIEVTLTIDGDGDATVDTGVGFFDHMLEAFAKHGLFD
LTVNCDGDLEIDDHHTVEDVAIVIGDAFSEALGDKRGIVRYADRQVPLDEAVAGVVVDVS
GRPYFDFDGEFSQEQIGDFTSDMARHFGYSLAMHAGLTLHTEIRGENAHHEAEALFKALA
RALDDATRVDPRRSDTPSTKGEL
Download sequence
Identical sequences E4NSY1
WP_006055650.1.71935 WP_006055650.1.94995 gi|313125044|ref|YP_004035308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]