SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313125047|ref|YP_004035311.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313125047|ref|YP_004035311.1|
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.17e-36
Family YigZ N-terminal domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 144-205
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 0.000000403
Family YigZ C-terminal domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313125047|ref|YP_004035311.1|
Sequence length 206
Comment hypothetical protein Hbor_02620 [Halogeometricum borinquense DSM 11551]
Sequence
MTDAYRTVAGPAEASFEVRGSEFIGYVDRANTVEKAEAFIDRIEERHPDATHNVPAYRVP
AGGDSGGANTMLREYSSDDGEPSGSSGKPALNVLVQQEIRNVVAVVTRYYGGTNLGVGGL
ARAYSRGVKEAVEAAGTVEEVPHETFSVTVAYDDSGSVRGLLESADVSFDAAYEADVSFD
VRVPVEEGAELRDRLRSATSGRADIE
Download sequence
Identical sequences E4NTC7
WP_006055653.1.71935 WP_006055653.1.94995 gi|313125047|ref|YP_004035311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]