SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313125810|ref|YP_004036080.1| from Halogeometricum borinquense DSM 11551

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313125810|ref|YP_004036080.1|
Domain Number 1 Region: 44-115
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 9.63e-19
Family Ribosomal S5 protein, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 129-208
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.45e-17
Family Translational machinery components 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313125810|ref|YP_004036080.1|
Sequence length 215
Comment 30S ribosomal protein S5 [Halogeometricum borinquense DSM 11551]
Sequence
MSQRNSNGWEPRTRLGRMVQEGDVTSMEQALETGLPLKEAEIVDQLLPGLEDEVLDINMV
QRMTDSGRRVKFRCVVAIGNRDGFLGYAEARDDQVGSAIQKAIDVAKLNIIKVDRGSGSW
EDSAGGLNSLTRKAEGKAGSVTVEIMPAPQGLGLAAAETVRNILELAGVQDAWTRSNGNT
RTTVNLAKGTYNALKNASQSRTPRRAREKQREAGN
Download sequence
Identical sequences E4NQ73
WP_006053859.1.71935 WP_006053859.1.94995 gi|313125810|ref|YP_004036080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]