SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330833922|ref|YP_004408650.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330833922|ref|YP_004408650.1|
Domain Number 1 Region: 31-83
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0000000000000748
Family Pseudouridine synthase II TruB 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330833922|ref|YP_004408650.1|
Sequence length 85
Comment pseudouridine synthase subunit A [Metallosphaera cuprina Ar-4]
Sequence
MNITPFIRRIDEFCNASLSWNTVKAYVPIGDFGSYPDKRSVPELIKTSIINLDKPPGPTS
HEVAFWIKNMFNLPRVGHGGTLELL
Download sequence
Identical sequences F4FXW8
WP_013736668.1.2613 gi|330833922|ref|YP_004408650.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]