SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834066|ref|YP_004408794.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834066|ref|YP_004408794.1|
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.35e-55
Family Extended AAA-ATPase domain 0.000000601
Further Details:      
 
Domain Number 2 Region: 435-601
Classification Level Classification E-value
Superfamily vWA-like 1.93e-20
Family Integrin A (or I) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834066|ref|YP_004408794.1|
Sequence length 607
Comment protoporphyrin IX magnesium-chelatase [Metallosphaera cuprina Ar-4]
Sequence
MRRTFPFSAIVGQEKLKRALLIVAVDSTIAGVLIKGPKGVAKSTAVRALANLLPEIEVVA
DCPFSCDPDNKEKMCSSCRSRIESGEKLPRLKRKKKIVDLPVSATLDRVVGTLDIKKILK
EGERGLEPGLLAQANRGILYIDEVNLLPDDVVNAILDAASSKYNVVEREGVSIVHPADFI
LIGTMNPEEGELRPQLLDRFAISVEAEAPKTPEELIEISNRVEEFERTQEKFLKAYEEEE
EKLKKKIYDATLILPRVTISEAHLKYIADTILTFSASTRAMIYAVKVAKALASLDGRVEV
NERDVKDALELVLSHRVPNFDRSSLPNVSKNERSDTSESPTFQGNTQWKEELSNRVSKER
DETEPNHSEISIPKSKVKGTGFGKGGLFDSILGKYRGEGLHLDLYASLINMALHKRSWLE
PQDLSIKGVESTGALPILLLLDSSKSMEFSKRISLAKSILKGLLIKAYQIRSKVGLVTFS
GFSSEYVVPITKNFKKVESSIEAVRPSGKTPISSALALAIQIINRETRSRRGVLPIVFLI
SDGKANVGLRNNIANELSELSSKLGKISKVIVIDTSMPHQPSFNNLISSKANGILIRANN
FITDLHI
Download sequence
Identical sequences F4FYS1
WP_013736810.1.2613 gi|330834066|ref|YP_004408794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]