SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834472|ref|YP_004409200.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|330834472|ref|YP_004409200.1|
Domain Number - Region: 53-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00024
Family GHMP Kinase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330834472|ref|YP_004409200.1|
Sequence length 285
Comment beta-ribofuranosylaminobenzene 5'-phosphate synthase [Metallosphaera cuprina Ar-4]
Sequence
MLRVIGLSRIHITLFDLEGKHGRIDGGMGVALERPRVVVSSEPCQTVSVVGLPPSKICIK
EDYEEHVGLGHTTQYLLSVAKLISELNLEKKSATELAKMVKRGGTSGVGVHAFERGGFVV
DGGHSTKVKSSPLPSDYSSSPPPPLLLRYDFPWYVYVNIPEGKRIFGTNELNAFKLPVTG
ADELSRVTLMEFIPSVAERDISGVLDALWKIQGLGFKKIEVELQSENVKNFMKNLYVKGF
PPGLSSFGPAVYTFVPTKREGEELVSRFGGWVTRPNNVGARVEWS
Download sequence
Identical sequences F4G126
WP_013737214.1.2613 gi|330834472|ref|YP_004409200.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]