SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834528|ref|YP_004409256.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834528|ref|YP_004409256.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily SirA-like 0.00000000000000327
Family SirA-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330834528|ref|YP_004409256.1|
Sequence length 86
Comment hypothetical protein Mcup_0667 [Metallosphaera cuprina Ar-4]
Sequence
MEELNLLDLECPEPFMRVAAKLMKMKEGKLKVTFRDPKCDEMIMEAVKLMDCKVLEHSSN
NGTFTLVLEKSNAPGNENKVQELGGC
Download sequence
Identical sequences F4G1F9
gi|330834528|ref|YP_004409256.1| WP_013737270.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]