SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834639|ref|YP_004409367.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834639|ref|YP_004409367.1|
Domain Number 1 Region: 39-199
Classification Level Classification E-value
Superfamily vWA-like 1.19e-30
Family Integrin A (or I) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834639|ref|YP_004409367.1|
Sequence length 383
Comment von Willebrand factor, type A [Metallosphaera cuprina Ar-4]
Sequence
MTLSMKVEYSHKYSFTSEIKMVFKILLVPERTSTATGFHYIVLLDTSGSMEGLKIESAKK
GAIELLKRIPQGNKVSFITFSSRVNVVREFVDPEDLTNEIVNLNAGGQTALFTALLTAFN
LHNKHGVPSYVILLTDGNPTDDTNIETYRRLQIPSSVQAVSFGLGDDYNESILKSLADKS
GGVFYHVSDAMEIPERLPKAAKTKIAAKNVTVDIVAESNVRLLNYSGPPVKINAVEGVIK
ILGEAVIPPNYNGNFMTVKVNYQEPTDERNQALLSVINISSAQNQAMFVNGVNKDVLLEY
EYFNNLQKVSTEVEAGNLVEATRTLKRMEEIAGQTRKIELMETTRRLSDSLETTKRSSNA
SEQTRKLSKEVSSEVTRKLRGES
Download sequence
Identical sequences F4G1Z4
gi|330834639|ref|YP_004409367.1| WP_013737381.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]