SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834684|ref|YP_004409412.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834684|ref|YP_004409412.1|
Domain Number 1 Region: 2-69,150-318
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.59e-71
Family Pyruvate kinase 0.0000362
Further Details:      
 
Domain Number 2 Region: 302-444
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.22e-26
Family Pyruvate kinase, C-terminal domain 0.0032
Further Details:      
 
Domain Number 3 Region: 64-150
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 2.79e-16
Family Pyruvate kinase beta-barrel domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834684|ref|YP_004409412.1|
Sequence length 445
Comment pyruvate kinase [Metallosphaera cuprina Ar-4]
Sequence
MSRKTRIVATLGPSLEKLVDKVKDYVDVFRINLAHGDSDSHKRYFELIKTQAPDSSILAD
LPGPKLRVGDIGKVELKRGQEVVFSPDHGIIVQEALFYKSIKPGSTILLSDGLIRIRIKT
VDKDSAVGEVLTPGVLTSRKGINIPDMTLDYGLTDNDFRLLDEALSLGADYIGLSFVLSE
NDVIKAKEKINNRAWVISKIEKNQAVNRLFKIVEESDGVMVARGDLGVEIGLENLPYVQR
KIIKVSKLLGKPVILATQVLESMVSNPLPSRAEVIDVANSVYQGVDAIMLSDETAVGQYP
FEAIQYLNNIIKSSEDKVKPMRPSPMKSTDDAVAFSSVSLSELSKSEVIAVHSRSGLSVI
RVSRLRPKASILAFTPDPVVARRVKLCWGVYPFTLNENPGDLNELVTTLDKKCRELGVRG
NLVIVAGDPKMESGRTNLLKLHHID
Download sequence
Identical sequences F4G280
WP_013737426.1.2613 gi|330834684|ref|YP_004409412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]