SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330835725|ref|YP_004410453.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835725|ref|YP_004410453.1|
Domain Number 1 Region: 26-182,242-356
Classification Level Classification E-value
Superfamily Pseudouridine synthase 9.06e-45
Family tRNA pseudouridine synthase TruD 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330835725|ref|YP_004410453.1|
Sequence length 361
Comment tRNA pseudouridine synthase D, TruD [Metallosphaera cuprina Ar-4]
Sequence
MHPLDIAIGIEFKVHEWEPLKAEIPRPDGFKVVEEIDRRPCNEWKGVDSGKYAVYLLRKR
GLDHFSVMAKLTKILGERPGYLGIKDANASTEQLIYVRKKRIESYSNSSFSIEFKGFTNQ
KLNHTGNRFEITLVSDEAELTKRVEMIKREGTLPAFIGYQRFGTRRPITHLIGKALSQRD
WCKAVDFILGYPFSEEKKEIKQFRKDYMKRKTDRLQISNVPKQEREVYLELNSSGSCLSA
LKRSPVKLSFYLEAFQSYLFNRVLSRKLINSTTNEKDEIVIHVKPELCDTECKEVFEEEM
VDKNSFLIEELGIRLKPLKRKAFMNISSIELNQELKFSLERGMYATVVLSEILNTDPKSF
T
Download sequence
Identical sequences F4G182
WP_013738467.1.2613 gi|330835725|ref|YP_004410453.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]