SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330835832|ref|YP_004410560.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835832|ref|YP_004410560.1|
Domain Number 1 Region: 7-264
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-70
Family G proteins 0.00000335
Further Details:      
 
Domain Number 2 Region: 469-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.09e-52
Family Translational machinery components 0.0000363
Further Details:      
 
Domain Number 3 Region: 261-378
Classification Level Classification E-value
Superfamily Translation proteins 9.82e-31
Family Elongation factors 0.00098
Further Details:      
 
Domain Number 4 Region: 630-720
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.91e-23
Family EF-G/eEF-2 domains III and V 0.0018
Further Details:      
 
Domain Number 5 Region: 393-469
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 8.27e-22
Family EF-G/eEF-2 domains III and V 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330835832|ref|YP_004410560.1|
Sequence length 736
Comment elongation factor EF-2 [Metallosphaera cuprina Ar-4]
Sequence
MPKYKTSEQVLSLMKDRTRVRNIGIIAHVDHGKTTTSDQLLAASGIISPKVAGEALALDY
LSVEQQRGITVKAANVSLYHEVEGKGYVINLIDTPGHVDFSGRVTRSLRVLDGSIVVVDS
VEGVMTQTETVLRQSLEERVRPILFVNKVDRLVKELKLGPQEMMQKLMDIIKEVNNLINI
YAEPDLKEKWSINPSLGNVVFGSAKDRWGFSIPMAQKKGINMKHVIDAYSVSDKTKINEL
ASQVPINEALLDAVIKFVPNPVEAQKYRIPKIWKGDLDNELAKAMLAADPNGPVVMMITD
MKVDPHAGLVATGRVFSGTIKPGSEVWLVNAKAPQKVLQVSIYMGQFRELADEIPAGNIA
AVLGLERARSGETLIDVRFKDLQGSFEKLHYVSEPVVTIAVEPKNPKDLTKMIDALRKLS
IEDPNLVVKINEETGEYLLSGMGFLHVEVSLQLLKDNYGVDVVTTPPIVVYRESVRNKSQ
VFEGKSPNKHNKFYISVEPLNDKTIELISNGTIKEDMDSKEMAKILRDQADWDYDEAKKI
VAIDENVNVLIDATSGVQHLREIIDTLLQGYRLAMREGPLAHEPVRGVKVVLHDATIHED
PAHRGPAQIYPAVRNAIFAAMLMSKPTLLEPLQKLDIRVPMEFVGNVTAVLSRKRGKILN
MTQTGNVARVLAEIPVSESYELASDLRGSTGGRAFWGTEFSKWAPVPDSILTDVVLKIRE
RKGLPKELPKVEDFLS
Download sequence
Identical sequences F4G1R9
gi|330835832|ref|YP_004410560.1| WP_013738574.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]