SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330835834|ref|YP_004410562.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835834|ref|YP_004410562.1|
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily Prefoldin 2.3e-23
Family Prefoldin 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330835834|ref|YP_004410562.1|
Sequence length 128
Comment prefoldin subunit beta [Metallosphaera cuprina Ar-4]
Sequence
MAERIPPELQTQLLKLQQLQNQLERLTYEKSVIEGELREVNEVLKELTNIPQDAPVYKIV
GNLLVKQERTNVQNELNERKELLELKSRTYQKQEGLLRKQFEDLQKKVNELVQKYYPQGT
QGSSPPKA
Download sequence
Identical sequences F4G1S1
gi|330835834|ref|YP_004410562.1| WP_013738576.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]