SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330835837|ref|YP_004410565.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835837|ref|YP_004410565.1|
Domain Number 1 Region: 10-176,205-218
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-54
Family Ribonuclease PH domain 1-like 0.000000254
Further Details:      
 
Domain Number 2 Region: 192-271
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.21e-16
Family Ribonuclease PH domain 2-like 0.0000574
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330835837|ref|YP_004410565.1|
Sequence length 283
Comment exosome complex RNA-binding protein Rrp42 [Metallosphaera cuprina Ar-4]
Sequence
MSMTPTKENVVPLIKKESIISLLERGSRNDGRKFNDYRPLSITLGYAKKADGSALVKLGD
TTVLAGVKIEEDEPYSDTPNQGNLVVNAELLPLAYETFEPGPPDENAIELSRVVDRSLRD
SKAVDLSALVIEPGKRVWTVWVDISVLDYGGNILDACTLSAVAALYDTKLPRIVNDNGTI
NIVKEDKTTPFPIRYPVATVTIAKLGKFLVVDPDLEEEGIMDAKISFSYIPDGHIVGIQK
SGEGSFSQQEIEIAENTSRTVSQKMLEDFKNIMGIKVVNNNAS
Download sequence
Identical sequences F4G1S4
gi|330835837|ref|YP_004410565.1| WP_013738579.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]