SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330835838|ref|YP_004410566.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835838|ref|YP_004410566.1|
Domain Number 1 Region: 9-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.35e-44
Family Ribonuclease PH domain 1-like 0.00000062
Further Details:      
 
Domain Number 2 Region: 153-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.8e-24
Family Ribonuclease PH domain 2-like 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330835838|ref|YP_004410566.1|
Sequence length 245
Comment exosome complex exonuclease Rrp41 [Metallosphaera cuprina Ar-4]
Sequence
MLQVQKPKLILDDGRRLDGRRPDELRPMKMEIGVLKNADGSSLVEVGNTKIIAAVYGPRE
MHPRHLALPNRATLRVRYHMTPFSTDERKSPVPSRREIELSKVIREALESSVLVEQFPRS
SIDVFMEVIQADAGTRLASLMAASLAIIDAGIPVRDAIAAVAVGKADGVVVLDLNEPEDM
WGEADMPVAMMPSLGQITLIQLNGHMTPEEFKQGLDLAYKGINTIYSMEKEVLKSKFAEM
REEGS
Download sequence
Identical sequences F4G1S5
WP_013738580.1.2613 gi|330835838|ref|YP_004410566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]