SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330833923|ref|YP_004408651.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330833923|ref|YP_004408651.1|
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.03e-33
Family Pseudouridine synthase II TruB 0.0000389
Further Details:      
 
Domain Number 2 Region: 137-214
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000000133
Family PUA domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330833923|ref|YP_004408651.1|
Sequence length 219
Comment pseudouridine synthase subunit B [Metallosphaera cuprina Ar-4]
Sequence
MEVHCDVNESEIMDVAKTFIGKIYQKPPVRSSVKRRVRKREVYSIDVLEIDKRKVLMRIS
SEPGTYMRKICHDMGILLNCGAHMRELRRVRSGIFKEDTLVTLQQVSEALYLYRNCGEEE
ELRKILMPMEIAFCGVPKIIVDDETVNSISYGSPLMAPGIIAYQDFKKGDYVGLITWKGE
GIAIGKAVIDSKQLGKKGEVVKTERVLMDKDIYPKAWKK
Download sequence
Identical sequences F4FXW9
WP_013736669.1.2613 gi|330833923|ref|YP_004408651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]