SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330834518|ref|YP_004409246.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834518|ref|YP_004409246.1|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-33
Family GHMP Kinase, N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 171-306
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.32e-17
Family Phosphomevalonate kinase (PMK) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834518|ref|YP_004409246.1|
Sequence length 318
Comment phosphomevalonate kinase [Metallosphaera cuprina Ar-4]
Sequence
MEVSAPGKILWIGSYSVVFGGISHVIAINKRVRCKHERSDRLEFITSYGIFKEGENELID
SVLKVIRERFPIIKGRIHLVNDEGFQIDGKKTGLGSSSAATVALTACLMRVLTGEFDLNE
IYRLSQKANYLRQKGIGSGFDIAAATFGSVVYRRFKDVEKVDSTVKPLRVHDYQILLGFT
GRSANTIDLVRRFHQMENVPRFKELMKEIEIDNEMAIKLLEMGMLDNAIPHIKLARRYLN
VLAKDVVGLEIENEEDRKIIELAERNGAFISLMPGAGGGDLIMAMGEDLKRVEQAWQRIG
IKTIYVRQDEGVRVENRS
Download sequence
Identical sequences F4G1E9
WP_013737260.1.2613 gi|330834518|ref|YP_004409246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]