SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479171700|ref|YP_007799887.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479171700|ref|YP_007799887.1|
Domain Number 1 Region: 50-174
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.19e-43
Family Insert subdomain of RNA polymerase alpha subunit 0.0000309
Further Details:      
 
Domain Number 2 Region: 5-50,175-229
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 3.53e-31
Family RNA polymerase alpha subunit dimerisation domain 0.00062
Further Details:      
 
Domain Number 3 Region: 251-316
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 2.62e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479171700|ref|YP_007799887.1|
Sequence length 318
Comment DNA-directed RNA polymerase subunit alpha [Faecalibacterium prausnitzii SL3/3]
Sequence
MMEIERPKIETASLSPDGRYGKFVAEPLERGFGITLGNSLRRVLLSSLPGVAVTSVKIDG
VVHEFSTIEGVKEDVTEIVLNLKGIAAKLYTDGPKTVRVEAVGPCEVTADNIKQGDDIEI
LNPEWHIATLGEGAKLVMELTFDKGRGYVPAERNKQAIIEKNDINTLPVDSIYTPVLKVN
YNVESTRVGQAIDYDKLTIEVWTDGTINAQEAVSLAARVLTEHLNLFVNLSDEAAGAEIM
VEKTNDDKEKALEMTIEELDLSVRSFNCLKRAGINTVEDLVSKSEDEMMKVRNLGRKSLE
EVMAKLDSLGFKLNTDDE
Download sequence
Identical sequences A0A173TBA0 D4K9I1
WP_015537248.1.34810 WP_015537248.1.86991 gi|479171700|ref|YP_007799887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]