SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479171773|ref|YP_007799960.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479171773|ref|YP_007799960.1|
Domain Number 1 Region: 35-135
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000241
Family N-type ATP pyrophosphatases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479171773|ref|YP_007799960.1|
Sequence length 206
Comment Uncharacterized protein conserved in bacteria [Faecalibacterium prausnitzii SL3/3]
Sequence
MATQRNYAQQMDAVLAGLGGTRPRLLLHACCGPCSSAVLEQLCRYFEITVLYYNPNTWPA
AEYYRRGEELQKFVAAAHPLGVTVVEDTYDPQQFYTAVAGLENEPERGSRCTVCYRLRMR
RAAQYARDNGFDWFTTTLSISPHKDAARINAIGQELETEFGVKHLPSDFKKHNGYLRSLQ
LSEQYGLYRQDYCGCEFSAKARGIEG
Download sequence
Identical sequences D4K9Q4
gi|479171773|ref|YP_007799960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]