SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479171884|ref|YP_007800071.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479171884|ref|YP_007800071.1|
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.97e-47
Family PP-loop ATPase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479171884|ref|YP_007800071.1|
Sequence length 253
Comment Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Faecalibacterium prausnitzii SL3/3]
Sequence
MRKAVQDYEMIAPGDRVMVGVSGGKDSVALTIGLSMLRKYIGFDYEVVAVTLDPQFDHQP
MDYSALAELFRQHGIPYEVRRTEIGPVVFEYRKEKNPCALCAKLRRGALHTAAQELGCNK
VALGHHLDDAVETFYMNLWREGRIGCFSPVTYLSQRDLTLIRPMLLATEYEVQCAVREAG
LPIVKSRCPADGVTVREQTKEFVQERCRTDHAFRQKTLHALQESGIDGWRPVHTGRGSFI
VPKKETDHAETTV
Download sequence
Identical sequences D4KA15
gi|479171884|ref|YP_007800071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]