SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479172114|ref|YP_007800301.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479172114|ref|YP_007800301.1|
Domain Number 1 Region: 192-460
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.76e-62
Family N-type ATP pyrophosphatases 0.00000446
Further Details:      
 
Domain Number 2 Region: 5-174
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.14e-36
Family Class II glutamine amidotransferases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479172114|ref|YP_007800301.1|
Sequence length 524
Comment asparagine synthase (glutamine-hydrolyzing) [Faecalibacterium prausnitzii SL3/3]
Sequence
MGYTGHDLSAEKFKEYLLRTVDRGPDDQRVVEGPYGLMGFGRLAIMGLTPEGMQPFYRGA
DCVVCNGELYGFRFEKEILKRRGYKFCSDCDCEILLPLYYEYGLDMFRHMDAEFALILYD
SRKDRLIAARDPIGIRPLFYGYSKSSHKIAFSSEMRNLIGWCDDIRPFPIGSYYCDGRFV
RYEDIADVPAPMQDDMPTILQNIREKLIAGVEKRLDADAPVGFLLSGGLDSSLVCSIAAK
KLGKPIRTFAIGMDTDAIDLKYARQTADYLGSEHHEIIINREMVLSSLEEVIRLLGTWDI
TTIRASMGMYLLCKAIHEQTDVRVLLTGEISDELFGYKYTDYAPTADAFQQESQKRIREL
YMYDVLRADRCISSNSIEARVPFGDLDFVRYVMAIDPEKKLNRYGKGKYLLRKAFEGDWL
PPEILWREKAAFSDAVGHSMVDDIKEYAESLYTDEEFQMRRANYSAHCMPFTKESLFYRE
IFEKYYHDQSRTIVGFWMPNKAWPGCNVNDPSARVLANYGASGV
Download sequence
Identical sequences A8SD87 D4KAP5
WP_005920533.1.86991 gi|479172114|ref|YP_007800301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]