SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479172128|ref|YP_007800315.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479172128|ref|YP_007800315.1|
Domain Number 1 Region: 16-118
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 4.84e-35
Family N-utilization substance G protein NusG, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 121-182
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000000236
Family N-utilization substance G protein NusG, C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479172128|ref|YP_007800315.1|
Sequence length 183
Comment transcription antitermination protein nusG [Faecalibacterium prausnitzii SL3/3]
Sequence
MEESTKLVDESTEALWYVVHTYSGYENKVANDLQTMVENRHLQELICDIKVPVEMVPEID
KNGKQKMVEHKLFPGYVLVKMVMNDDTWYVVRNTRGCTGFVGPASKPVPLTAEEVEKMGV
EKAAPLSVDFAVGDTVQITAGPLEGFMGLVEAIDTENFKVKLKVNMFGRETPAEVEIGQV
ELP
Download sequence
Identical sequences A0A2A7A048 A8SD63 D4KAQ9
gi|479172128|ref|YP_007800315.1| WP_005920497.1.86991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]